PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn197641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 268aa    MW: 29674.2 Da    PI: 8.884
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn197641genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.71e-3164119359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++r++eC+kNhAas+Gg+++DGCgEfmps ge+gt +alkCaAC+CHRnFHRre+++
   Achn197641  64 GARFRECMKNHAASVGGNVLDGCGEFMPS-GEDGTLEALKCAACNCHRNFHRREPDH 119
                  579*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015668.5E-3066116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.6E-2966117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2166118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.64567116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.57E-16187248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28188251IPR009057Homeodomain-like
TIGRFAMsTIGR015655.3E-28189246IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEVKGQQGSL GYNNNPIFRE TSETLDRHHP LQQNSTRRQN PDQFNGSGGE RVAYKSGGSS  60
FITGARFREC MKNHAASVGG NVLDGCGEFM PSGEDGTLEA LKCAACNCHR NFHRREPDHG  120
SEFALHLPPP LPSPSYRQHQ RLWNPIVSPV KIAFGGGGGT DSSSEDLNFN TVQSNAAGAP  180
LPPPFVLSKK RFRSKFTQEQ KEKMLEYAEK VGWRIPREDD AEMQRFCAEV GVKRQVLKVW  240
MHNNKNSSTK KPPQEGESQG TFRLGCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-251882471675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.12e-84PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW71e-61ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A061FD051e-83A0A061FD05_THECC; Homeobox protein 33 isoform 1
STRINGPOPTR_0002s03660.11e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.15e-60homeobox protein 33